Transcript | Ll_transcript_337348 |
---|---|
CDS coordinates | 110-1081 (+) |
Peptide sequence | MTGEHTSPPDSDALKAPLLPLHQHIQTTYTTHLNIKSVLTLQNFYVILGPLLSLIICLFVSLDAPVTSKKMLAVLAWVFAWWVTEAVPLPVTSLCPLFLFPLFGVATADSVAHSYMDDVITLVLGSFILALAVERYNVHRRLALNVTLLFCGERLNPSLLLLGLCATTFFVSMWLHNVAAAVMMMPVATGILHRLPPPQEQSNTVNKFSRAVVLTVVYATPIGGMSTLTGTGVNVILIGMWKSLAPDAKPISFNNWFCFGFPVAVIMLLCFWCIICLLYVKKDSGRALSSYLDKAHLKTDLEALGPMAFAEKMVLLVFGVCIP* |
ORF Type | complete |
Blastp | Tonoplast dicarboxylate transporter from Arabidopsis with 60.24% of identity |
---|---|
Blastx | Tonoplast dicarboxylate transporter from Arabidopsis with 60.24% of identity |
Eggnog | Transporter(COG0471) |
Kegg | Link to kegg annotations (AT5G47560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419392.1) |
Pfam | Sodium:sulfate symporter transmembrane region (PF00939.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer