Protein coding transcript 57885

• Transcript: Ll_transcript_337351
• CDS coordinates: 491-1072 (+)
• Peptide sequence: MVAVLLFIIPNMKQKGEKLMSWNECKKLPWNLILLLGAGFALADGVQSSGLADVLSRALDFLEDVPYIAIATAVSLMSSIITEFITSNDATATLILPLLYHIGKTMHVHPLLLMIPGAIATEFAFLLPTSTPSNVVGFTTGHIEIQDLLKVGVPLKVVGIAVLSFLMPTLGAIVFGTDEGKWVTRANSRWLGN*
• ORF Type: complete

Annotations of Ll_transcript_337351

• Blastp: Tonoplast dicarboxylate transporter from Arabidopsis with 67.22% of identity
• Blastx: Tonoplast dicarboxylate transporter from Arabidopsis with 67.4% of identity
• Eggnog: Transporter(COG0471)
• Kegg: Link to kegg annotations (AT5G47560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419392.1)
• Pfam: Sodium:sulfate symporter transmembrane region (PF00939.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;