Protein coding transcript 57889

• Transcript: Ll_transcript_337338
• CDS coordinates: 1770-2372 (+)
• Peptide sequence: MKKEWLSYNHSYQRIISMLTPTTSETWNKGCVIYAKKSSGKAWMQPVLHVNKKFVWPNHAKQVSISSIDNPALANFCETVDKANSSHSFTEGLALSVGLSKQPLRARGAMKYVAIAHGNAEVFMKFARASYKEKIWDHAAGVIIIEEAGGIVTDVRGDPLDFSKGLYLEGLDRGIVACAGATLHEKIIDAIDASWSSSCL*
• ORF Type: complete

Annotations of Ll_transcript_337338

• Blastp: PAP-specific phosphatase HAL2-like from Arabidopsis with 58.5% of identity
• Blastx: PAP-specific phosphatase HAL2-like from Arabidopsis with 56.83% of identity
• Eggnog: 3'(2'),5'bisphosphate nucleotidase(COG1218)
• Kegg: Link to kegg annotations (AT5G54390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445630.1)
• Pfam: Inositol monophosphatase family (PF00459.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;