Transcript | Ll_transcript_337339 |
---|---|
CDS coordinates | 1770-2216 (+) |
Peptide sequence | MKKEWLSYNHSYQRIISMLTPTTSETWNKGCVIYAKKSSGKAWMQPVLHVNKKFVWPNHAKQVSISSIDNPALANFCETVDKANSSHSFTEGLALSVGLRCNFISFHSILVTLSLSIGFSPLLLLVSRHSNIGFIPMLLFFPLTSICH* |
ORF Type | complete |
Blastp | PAP-specific phosphatase HAL2-like from Arabidopsis with 37.69% of identity |
---|---|
Blastx | PAP-specific phosphatase HAL2-like from Arabidopsis with 46.33% of identity |
Eggnog | 3'(2'),5'bisphosphate nucleotidase(COG1218) |
Kegg | Link to kegg annotations (AT5G54390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445630.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer