Protein coding transcript 57890

• Transcript: Ll_transcript_337339
• CDS coordinates: 1770-2216 (+)
• Peptide sequence: MKKEWLSYNHSYQRIISMLTPTTSETWNKGCVIYAKKSSGKAWMQPVLHVNKKFVWPNHAKQVSISSIDNPALANFCETVDKANSSHSFTEGLALSVGLRCNFISFHSILVTLSLSIGFSPLLLLVSRHSNIGFIPMLLFFPLTSICH*
• ORF Type: complete

Annotations of Ll_transcript_337339

• Blastp: PAP-specific phosphatase HAL2-like from Arabidopsis with 37.69% of identity
• Blastx: PAP-specific phosphatase HAL2-like from Arabidopsis with 46.33% of identity
• Eggnog: 3'(2'),5'bisphosphate nucleotidase(COG1218)
• Kegg: Link to kegg annotations (AT5G54390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445630.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;