Protein coding transcript 57933

• Transcript: Ll_transcript_338662
• CDS coordinates: 176-655 (+)
• Peptide sequence: MVYHSSFVDENGVNIACGCPLLPLKSHIKGPAPVSDQDSTDIVDEAITFFRANVFFRNFDIQSPADKLLIYLTFYINIALKRLEGCRTLAEGTKAVINLGLEKVPVPGESGFPFPGLFPLPRSHHEAGQSLLRLSLCIFILFLYLIFTVVLLLVPLMDR*
• ORF Type: complete

Annotations of Ll_transcript_338662

• Blastp: Actin-related protein 2/3 complex subunit 3 from Arabidopsis with 86.61% of identity
• Blastx: Actin-related protein 2/3 complex subunit 3 from Arabidopsis with 88.18% of identity
• Eggnog: protein 2 3 complex, subunit(ENOG4111FTG)
• Kegg: Link to kegg annotations (AT1G60430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452907.1)
• Pfam: ARP2/3 complex ARPC3 (21 kDa) subunit (PF04062.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;