Protein coding transcript 57981

• Transcript: Ll_transcript_337687
• CDS coordinates: 3100-3654 (+)
• Peptide sequence: MLRLSQLPSYWYSLVSYFIYLYFFPLLNLVAFQIIPILQFYVSHIHCFLELQYELCFSFRSAIILGTCIPLVLFLIWNAVILGTVSDNVMGLDPIQQLRSTNGTVGPIVEVFSLLAIATSYIGFVLGLSDFLADLLKLPTTSENRPLPYILTLVPPLILSLLDPEIFFKALDFAGTYGVLVLFGV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_337687

• Blastp: Tyrosine-specific transport protein 2 from Haemophilus with 36.43% of identity
• Blastx: Tyrosine-specific transport protein 2 from Haemophilus with 36.43% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (HI0528)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460267.1)
• Pfam: Tryptophan/tyrosine permease family (PF03222.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;