| Transcript | Ll_transcript_337693 |
|---|---|
| CDS coordinates | 70-468 (+) |
| Peptide sequence | MVIMLSSHSPFFQIPTLLIQPRNHHHHHHHQITFQQSLFTCVYPLRTNLHKCFLQKQSKAEQEQEQEVFEFERLFSNLNQATLKREPGWCILHFFSLLYNYCYCEVCVLKSPSCLLLLLLLPSKLFRVKISF* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Tyrosine-specific transport protein from Shigella with 28.19% of identity |
| Eggnog | amino acid transport(COG0814) |
| Kegg | Link to kegg annotations (SF1953) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460267.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer