Protein coding transcript 57994

• Transcript: Ll_transcript_337674
• CDS coordinates: 1765-2244 (+)
• Peptide sequence: MARSSDILTNFLGIPIWGSATLFSLIFGGICFFGSQRFIGAVNGALVIGIISSFAILVAVASGDLHLSALLKANFEAAPMSIPIVALSFVYQNVVPVLCTNLEGDLVKVRSAIILGTCIPLVLFLIWNAVILGTVSDNVMGLDPIQQLRSTNGTVGVSL*
• ORF Type: complete

Annotations of Ll_transcript_337674

• Blastp: Tyrosine-specific transport protein from Shigella with 34.92% of identity
• Blastx: Tyrosine-specific transport protein from Shigella with 26.95% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (SF1953)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460269.1)
• Pfam: Tryptophan/tyrosine permease family (PF03222.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;