Transcript | Ll_transcript_338376 |
---|---|
CDS coordinates | 395-1231 (+) |
Peptide sequence | MAKCSDPENNNMIVEGRKDSLIRACLTCGHHIKCQDQGGGIHDLPGLPAGVKFDPNDQEILEHLEAKVRYDIHKLHPLIDEFIPTLEGENGICYTHPEKLPGVSKDGMIRHFFHRPSKAYTTGTRKRRKVHSDEDGSETRWHKTGKTRPVYSSAKLKGYKKILVLYTNYGKQRKQEKTNWVMHQYHLGSDEEEKEGELVVSKVFYQTQPRQCGKDSVPAKVMKGQGVHDEIINNNNKNNGFVDYYHSNFISFGQGGQHRSSSEVISHFPGHGGAPFIP* |
ORF Type | complete |
Blastp | NAC domain-containing protein 73 from Arabidopsis with 77.23% of identity |
---|---|
Blastx | NAC domain-containing protein 73 from Arabidopsis with 77.23% of identity |
Eggnog | NAC domain-containing protein 8-like(ENOG410YF7Q) |
Kegg | Link to kegg annotations (AT4G28500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450359.1) |
Pfam | No apical meristem (NAM) protein (PF02365.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer