Protein coding transcript 58097

• Transcript: Ll_transcript_338034
• CDS coordinates: 151-690 (+)
• Peptide sequence: MMDDGDNFSSMSLTTPTTSSRMRPKSPPPGLLNFHGKRKQLLKLQILETEILFLQEELKSLEGLLPASRCCKEVDDFVGSISDPFTPKKQTISQSHHFKKRISFPSWICCSNSCMIHNKITKGCFVCCSSSKSKCSGYNCLKTTTPSAQNCCKVPKLFSTYCACCLRCFSCKKSCGPLF*
• ORF Type: complete

Annotations of Ll_transcript_338034

• Blastp: Guanine nucleotide-binding protein subunit gamma 3 from Arabidopsis with 45.21% of identity
• Blastx: Guanine nucleotide-binding protein subunit gamma 3 from Arabidopsis with 45.21% of identity
• Eggnog: NA(ENOG410YVBK)
• Kegg: Link to kegg annotations (AT5G20635)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425191.1)
• Pfam: GGL domain (PF00631.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;