Protein coding transcript 58121

• Transcript: Ll_transcript_338072
• CDS coordinates: 149-511 (+)
• Peptide sequence: MVYRRALNDVNINGYLIPKDWIAITWFRNVHYDNDIYPNPREFNPYRWDITRKAGEFLPFGAGTRLCPGNDLAKLEISVFLHHFVMHYKLEPSNPNCAIRHLPHTRPKDNCLARIKKISA*
• ORF Type: complete

Annotations of Ll_transcript_338072

• Blastp: Ent-kaurenoic acid oxidase 2 from Arabidopsis with 62.93% of identity
• Blastx: Ent-kaurenoic acid oxidase 1 from Arabidopsis with 63.28% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT2G32440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435320.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;