Transcript | Ll_transcript_338072 |
---|---|
CDS coordinates | 149-511 (+) |
Peptide sequence | MVYRRALNDVNINGYLIPKDWIAITWFRNVHYDNDIYPNPREFNPYRWDITRKAGEFLPFGAGTRLCPGNDLAKLEISVFLHHFVMHYKLEPSNPNCAIRHLPHTRPKDNCLARIKKISA* |
ORF Type | complete |
Blastp | Ent-kaurenoic acid oxidase 2 from Arabidopsis with 62.93% of identity |
---|---|
Blastx | Ent-kaurenoic acid oxidase 1 from Arabidopsis with 63.28% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT2G32440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435320.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer