| Transcript | Ll_transcript_339262 |
|---|---|
| CDS coordinates | 1-462 (+) |
| Peptide sequence | HKPHTHKMSLCSTLSFVSPTCVTLPKPTSTSSTCFSSPTLPNLQGIFTKSKNSTRFFLNAGFNEYEPDLNEDPVDQFRTNGVAPEDFLYGKYDGHHTFNEGEQDKRPFSETFIEELTAGEPPTGFQGIISWLFPPAIAAGVFFHVPVILISKC* |
| ORF Type | 5prime_partial |
| Blastp | Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 37.96% of identity |
|---|---|
| Blastx | Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 80.26% of identity |
| Eggnog | NA(ENOG41127XZ) |
| Kegg | Link to kegg annotations (AT5G43750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464936.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer