Protein coding transcript 58144

• Transcript: Ll_transcript_339264
• CDS coordinates: 1-669 (+)
• Peptide sequence: HKPHTHKMSLCSTLSFVSPTCVTLPKPTSTSSTCFSSPTLPNLQGIFTKSKNSTRFFLNAGFNEYEPDLNEDPVDQFRTNGVAPEDFLYGKYDGHHTFNEGEQDKRPFSETFIEELTAGEPPTGFQGIISWLFPPAIAAGVFFHVPGEYLYIGAGIFTIIFCIIEMDKPDKPHHFEPQIYNMERGARDKLINDYNTMDIWDFNEKYGDLWDFTIKKDDIMSR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_339264

• Blastp: Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 53.05% of identity
• Blastx: Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 61.54% of identity
• Eggnog: NA(ENOG41127XZ)
• Kegg: Link to kegg annotations (AT5G43750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464936.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;