Transcript | Ll_transcript_339264 |
---|---|
CDS coordinates | 1-669 (+) |
Peptide sequence | HKPHTHKMSLCSTLSFVSPTCVTLPKPTSTSSTCFSSPTLPNLQGIFTKSKNSTRFFLNAGFNEYEPDLNEDPVDQFRTNGVAPEDFLYGKYDGHHTFNEGEQDKRPFSETFIEELTAGEPPTGFQGIISWLFPPAIAAGVFFHVPGEYLYIGAGIFTIIFCIIEMDKPDKPHHFEPQIYNMERGARDKLINDYNTMDIWDFNEKYGDLWDFTIKKDDIMSR* |
ORF Type | 5prime_partial |
Blastp | Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 53.05% of identity |
---|---|
Blastx | Photosynthetic NDH subunit of subcomplex B 5, chloroplastic from Arabidopsis with 61.54% of identity |
Eggnog | NA(ENOG41127XZ) |
Kegg | Link to kegg annotations (AT5G43750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464936.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer