| Transcript | Ll_transcript_337281 |
|---|---|
| CDS coordinates | 83-424 (+) |
| Peptide sequence | MSNAELASSYAALILADEGLEITADKLQSLISAAKVPEIEPIWTTLFAKALEGKDVKDLLLNVGSGGGAAPAAGGAAAGGAAAAADAPAEEKAEEKEEEKEESDEDMGFGLFD* |
| ORF Type | complete |
| Blastp | 60S acidic ribosomal protein P1 from Cladosporium with 91.15% of identity |
|---|---|
| Blastx | 60S acidic ribosomal protein P1 from Cladosporium with 95.24% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017409771.1) |
| Pfam | 60s Acidic ribosomal protein (PF00428.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer