Protein coding transcript 58201

• Transcript: Ll_transcript_337286
• CDS coordinates: 83-415 (+)
• Peptide sequence: MSNAELASSYAALILADEGLEITADKLQSLISAAKVQDIEPIWTTLFAKALEGKDVKDLLVNVGSGGGAAPAAGGAAPAAGGASDAPAAEEKKEEEKEESDDDMGFGLFD*
• ORF Type: complete

Annotations of Ll_transcript_337286

• Blastp: 60S acidic ribosomal protein P1 from Alternaria alternata group with 76.36% of identity
• Blastx: 60S acidic ribosomal protein P1 from Cladosporium with 84.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017409771.1)
• Pfam: 60s Acidic ribosomal protein (PF00428.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;