Transcript | Ll_transcript_338823 |
---|---|
CDS coordinates | 2230-2631 (+) |
Peptide sequence | MLFFFCSIFQVAAAYFAFLEILFNGHLSFVLSLDKTVLVFFLRSLEAGLKDLSEKISSQCAAAIDSLATFYFMHITVGESPVSPAAHNVARLMSDYPGIFSGILRTLFEDVILEDRGNQWSLGRAILSLILISE |
ORF Type | 3prime_partial |
Blastp | Ran-binding protein 17 from Homo with 31.3% of identity |
---|---|
Blastx | Ran-binding protein 17 from Mus with 32.06% of identity |
Eggnog | ran binding protein(ENOG410XRPR) |
Kegg | Link to kegg annotations (64901) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428725.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer