Protein coding transcript 58215

• Transcript: Ll_transcript_338823
• CDS coordinates: 2230-2631 (+)
• Peptide sequence: MLFFFCSIFQVAAAYFAFLEILFNGHLSFVLSLDKTVLVFFLRSLEAGLKDLSEKISSQCAAAIDSLATFYFMHITVGESPVSPAAHNVARLMSDYPGIFSGILRTLFEDVILEDRGNQWSLGRAILSLILISE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_338823

• Blastp: Ran-binding protein 17 from Homo with 31.3% of identity
• Blastx: Ran-binding protein 17 from Mus with 32.06% of identity
• Eggnog: ran binding protein(ENOG410XRPR)
• Kegg: Link to kegg annotations (64901)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428725.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;