Protein coding transcript 58278

• Transcript: Ll_transcript_338334
• CDS coordinates: 195-650 (+)
• Peptide sequence: MNRKMKMRVIVLLSVLMSVSVGRCWGEQCGRQAGGSVCPGGLCCSQFGWCGSTTEYCGTGCQSQCGGSGGGGGGGGGGDIGSIISRDNFNQILKHSNDAACPAKGFYTYDAFISAAKSFPNFASTGDTTTRKREIAAFLAQTSHETTGFFL*
• ORF Type: complete

Annotations of Ll_transcript_338334

• Blastp: Endochitinase from Phaseolus with 65.52% of identity
• Blastx: Chitinase 12 from Oryza sativa with 71.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015951276.1)
• Pfam: Chitin recognition protein (PF00187.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;