Protein coding transcript 58285

• Transcript: Ll_transcript_338342
• CDS coordinates: 47-892 (+)
• Peptide sequence: MCRMCAINLFRVFSPNYRLNRGGGGGGGENDDYPTFDPAWPHLQLVYELFLKFVSSSCLDAKVAKKYIDHWFISRLLELFDSEDPRERDCLKTILHRVYEKFMVHRPFIRKSINNIFYRFVFETEKHNGVAELLEIFGSIISGFALPLKDEHRMFLWRVLIPLHKPKSMAVYSQQLSYCVTQFIEKEPKLASTVIRGLLKYWPITNSQKEVMFLGELEEILDAINMVEFQMVMVPLFWRIGYCINSLHFQVQFLCYSESPLFAWPYPFQCYFSCRSQVHTL*
• ORF Type: complete

Annotations of Ll_transcript_338342

• Blastp: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 74.24% of identity
• Blastx: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 73.84% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XQJW)
• Kegg: Link to kegg annotations (AT5G25510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415465.1)
• Pfam: Protein phosphatase 2A regulatory B subunit (B56 family) (PF01603.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;