Transcript | Ll_transcript_338346 |
---|---|
CDS coordinates | 47-844 (+) |
Peptide sequence | MCRMCAINLFRVFSPNYRLNRGGGGGGGENDDYPTFDPAWPHLQLVYELFLKFVSSSCLDAKVAKKYIDHWFISRLLELFDSEDPRERDCLKTILHRVYEKFMVHRPFIRKSINNIFYRFVFETEKHNGVAELLEIFGSIISGFALPLKDEHRMFLWRVLIPLHKPKSMAVYSQQLSYCVTQFIEKEPKLASTVIRGLLKYWPITNSQKEVMFLGELEEILDAINMVEFQMVMVPLFWRIGYCINSLHFQVCSNTLFSKGPLIVS* |
ORF Type | complete |
Blastp | Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 75.1% of identity |
---|---|
Blastx | Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform from Arabidopsis with 71.13% of identity |
Eggnog | Protein phosphatase 2, regulatory subunit B(ENOG410XQJW) |
Kegg | Link to kegg annotations (AT5G25510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415466.1) |
Pfam | Protein phosphatase 2A regulatory B subunit (B56 family) (PF01603.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer