Protein coding transcript 583

• Transcript: Ll_transcript_445469
• CDS coordinates: 110-526 (+)
• Peptide sequence: MAAFRKLIFSNRSLSPPSPFLLTFRRGIAFKLFIGGLSYFTTEKVLSDTFSNYGQVVEAKIITDRMSEKSKGFGFVTFASQEEAENAITEMNGKALNGRVIFVDYAKLSTKTGGGGGMPIARGPPEPTPEGPEPTPDS*
• ORF Type: complete

Annotations of Ll_transcript_445469

• Blastp: Small RNA-binding protein 11, chloroplastic from Arabidopsis with 62.28% of identity
• Blastx: Small RNA-binding protein 11, chloroplastic from Arabidopsis with 61.47% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT5G06210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425244.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;