| Transcript | Ll_transcript_338265 |
|---|---|
| CDS coordinates | 2269-2646 (+) |
| Peptide sequence | MLKLLSFCVDAEFRNTGLERSASLAKDLEWFKEQGHTIPEPSSPGLTYAQYLTELSEKDPQAFICHFYNIYFAHSAGGRMIGKKVTKHMHRKTVKLLCIPQIMQIGGEVVCMYPPQTPPSGSFMH* |
| ORF Type | complete |
| Blastp | Heme oxygenase 1, chloroplastic from Arabidopsis with 53.29% of identity |
|---|---|
| Blastx | Heme oxygenase 1, chloroplastic from Oryza sativa with 79.27% of identity |
| Eggnog | Heme oxygenase(COG5398) |
| Kegg | Link to kegg annotations (AT2G26670) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417602.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer