Protein coding transcript 58364

• Transcript: Ll_transcript_338264
• CDS coordinates: 3-962 (+)
• Peptide sequence: YWCLTFFFKITSPSTSSIKISHPFSHTPLLIYLLLSFFPSSILPLHNLLSLQLHIFPALKSNPITMSSLTPVSQFNSLFNKPPLLSSSPSPIKFPVSVPFRLVSVPGMPRKGGAVVVSATLAEKQRKRYPGESKGFVEEMRFVAMKLHTKEQAKEGEKEVKEPEEKTVAKWEPSVDGYLKFLVDSKLVYDTLEKIVEEPAYPSYAEFRNTGLERSASLAKDLEWFKEQGHTIPEPSSPGLTYAQYLTELSEKDPQAFICHFYNIYFAHSAGGRMIGKKVTKHMHRKTVKLLCIPQIMQIGGEVVCMYPPQTPPSGSFMH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_338264

• Blastp: Heme oxygenase 1, chloroplastic from Arabidopsis with 63.23% of identity
• Blastx: Heme oxygenase 1, chloroplastic from Arabidopsis with 75.15% of identity
• Eggnog: Heme oxygenase(COG5398)
• Kegg: Link to kegg annotations (AT2G26670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417602.1)
• Pfam: Heme oxygenase (PF01126.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;