| Transcript | Ll_transcript_338917 |
|---|---|
| CDS coordinates | 206-616 (+) |
| Peptide sequence | MIFANLDTELFQARKDATQIVANLQRQAVQSKLIASDYLEKNMDLMNTLMVGYENTDMALHYGAMLRECIRHQIVAKYVLNSPRMKKFFDYIQLPNFDIAADAAATFKELLTRHKSTVAEFLSKNYEWVGAPSTQG* |
| ORF Type | complete |
| Blastp | Putative MO25-like protein At5g47540 from Arabidopsis with 80.17% of identity |
|---|---|
| Blastx | Putative MO25-like protein At5g47540 from Arabidopsis with 75% of identity |
| Eggnog | Calcium binding protein(ENOG410XP4S) |
| Kegg | Link to kegg annotations (AT5G47540) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019426319.1) |
| Pfam | Mo25-like (PF08569.10) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer