Protein coding transcript 58438

• Transcript: Ll_transcript_337260
• CDS coordinates: 507-926 (+)
• Peptide sequence: MIIWWSLNYLLFIYKIKGFVNKMEECMGACDCIITKAGPGTIAEAMIRGLPIILNGYIAGQEAGNVPYVVENGCGKFSKSPKEIAKIVSDWFGPKADELKAMSQNALKLARPDAVFKIVQDLHELVRQRSLHPEYSCTA*
• ORF Type: complete

Annotations of Ll_transcript_337260

• Blastp: Probable monogalactosyldiacylglycerol synthase, chloroplastic from Soja with 88% of identity
• Blastx: Probable monogalactosyldiacylglycerol synthase, chloroplastic from Soja with 88% of identity
• Eggnog: Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid intermediate I) to form undecaprenyl-pyrophosphoryl-MurNAc- (pentapeptide)GlcNAc (lipid intermediate II) (By similarity)(COG0707)
• Kegg: Link to kegg annotations (547469)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417923.1)
• Pfam: Glycosyltransferase family 28 C-terminal domain (PF04101.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;