Protein coding transcript 58441

• Transcript: Ll_transcript_336845
• CDS coordinates: 1989-2423 (+)
• Peptide sequence: MQARKKIMDILEKEISERRSGVGTRRVDFLQRLLENENKLTEDEVPKLTDTEIKDNILTMMIAGQDTVANAMTWIVKFVDENQEVLNELMKEQVQIDQKGTRSAYLTLEALNEMPYASKVVKEALWMASVVQWFPRVALLDCEIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_336845

• Blastp: Abscisic acid 8'-hydroxylase 1 from Arabidopsis with 34.48% of identity
• Blastx: Abscisic acid 8'-hydroxylase 4 from Arabidopsis with 28.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G19230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416683.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;