Protein coding transcript 58446

• Transcript: Ll_transcript_336874
• CDS coordinates: 153-503 (+)
• Peptide sequence: MASVVQWFPRVALLDCEIEGFKIKKGWNINIDARSIHLDPIVHNDADVFNPSRFSDESKPYSFLAFGMGARTCLGKNMAKAMLLVFLHRLITTYKCVLSIMDHINLILCMCEYSRS*
• ORF Type: complete

Annotations of Ll_transcript_336874

• Blastp: Abscisic acid 8'-hydroxylase 2 from Oryza sativa with 42.11% of identity
• Blastx: Abscisic acid 8'-hydroxylase 2 from Oryza sativa with 41.67% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416682.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;