Protein coding transcript 58471

• Transcript: Ll_transcript_337239
• CDS coordinates: 409-1497 (+)
• Peptide sequence: MAAKRVRIMAKEEGLEVRRKLAMLGVIPLLVGMLDHDKECVDSQIASLYALLNLGIGNDANKAAIVKVGAIHKMLALIDSPDSSVCEAIVANFLGLSALDSNKPIIGSSGAIPVLVRTLQDLDNKSSTQVKQDALRALYNLSITPTNISFILETDLVSFLVNSTGDMEVSERILSILSNLVSTPEGRKAISAVRDAIPIMMDVLSWTDSPQCQEKASYILMIMAHKSYGDRHTMIEAGIASPLLELTLLGTQLAQKRASRILECLRLDKGKQVSRRYRGNLGATVSAPICGSSSSFTKTEGRSLEDEDMMSEEKKAVKQLVQQSLQNNMRKIVKRANLHHDFVPSDRFTSFTSSSTSKSLAL*
• ORF Type: complete

Annotations of Ll_transcript_337239

• Blastp: U-box domain-containing protein 13 from Arabidopsis with 35.93% of identity
• Blastx: U-box domain-containing protein 13 from Arabidopsis with 35.9% of identity
• Eggnog: Ubox domain-containing protein(ENOG4110352)
• Kegg: Link to kegg annotations (AT3G46510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417584.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;