Protein coding transcript 58520

• Transcript: Ll_transcript_336486
• CDS coordinates: 123-584 (+)
• Peptide sequence: MWRSPNGTIRNILNGTVFREPIICRNIPRLVPGWKKPICIGRHAFGDQYRATDAIIKGPGKLKLVFVPEDGDTPTELDVYNFKGPGVALAMYNIDESIRAFAESSMTLAFAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEERWKQKFEEHSIW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_336486

• Blastp: Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial from Arabidopsis with 88.31% of identity
• Blastx: Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial from Arabidopsis with 88.55% of identity
• Eggnog: isocitrate dehydrogenase (NADp)(COG0538)
• Kegg: Link to kegg annotations (AT5G14590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426984.1)
• Pfam: Isocitrate/isopropylmalate dehydrogenase (PF00180.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;