Transcript | Ll_transcript_336486 |
---|---|
CDS coordinates | 123-584 (+) |
Peptide sequence | MWRSPNGTIRNILNGTVFREPIICRNIPRLVPGWKKPICIGRHAFGDQYRATDAIIKGPGKLKLVFVPEDGDTPTELDVYNFKGPGVALAMYNIDESIRAFAESSMTLAFAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEERWKQKFEEHSIW |
ORF Type | 3prime_partial |
Blastp | Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial from Arabidopsis with 88.31% of identity |
---|---|
Blastx | Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial from Arabidopsis with 88.55% of identity |
Eggnog | isocitrate dehydrogenase (NADp)(COG0538) |
Kegg | Link to kegg annotations (AT5G14590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426984.1) |
Pfam | Isocitrate/isopropylmalate dehydrogenase (PF00180.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer