Transcript | Ll_transcript_338439 |
---|---|
CDS coordinates | 168-1271 (+) |
Peptide sequence | MITVQGDHNRLYNHQPPPPPPQITGSAGSSRQQFTSDRVEPFSVKHEPASLTLLPLRGHDSNEVDEDFHLTLAHQMYKSGNYEQALEHSNIVYERNPLRTDNLLLLGATYYQLHDFDMCVSKNEEALRIDPHFAECYGNMANAWKEKGNIDLAIRYYLIAIELRPNFADAWSNLASAYMRKGRLTEAAQCCRQALAINPLMVDAHSNLGNLMKAQGLVQEAYSCYLEALRIQPSFAIAWSNLAGLFMESGDFNRALQYYKEAVKLKPSFPDAYLNLGNVYKALGMPQEAIVCYQHALQTRSNYGMAYGNLASVYYEQGQLDMAILHYKQAVACDPRFLEAYNNLVGLLVLSKFCFWNLQMCYLYAIA* |
ORF Type | complete |
Blastp | Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC from Arabidopsis with 74.77% of identity |
---|---|
Blastx | Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC from Arabidopsis with 74.77% of identity |
Eggnog | protein N-acetylglucosaminyltransferase activity(COG3914) |
Kegg | Link to kegg annotations (AT3G04240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452206.1) |
Pfam | Tetratricopeptide repeat (PF13181.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer