Transcript | Ll_transcript_445479 |
---|---|
CDS coordinates | 2-346 (+) |
Peptide sequence | DEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLNPTDKKKIEDSVEETIQWLDSNQLAEADEFEDKMKELEGICNPVIAKMYQGGADMGGAAMDDDAPPAGGSGAGPKIEEVD* |
ORF Type | 5prime_partial |
Blastp | Heat shock cognate 70 kDa protein 1 from Lycopersicon with 79.82% of identity |
---|---|
Blastx | Probable mediator of RNA polymerase II transcription subunit 37c from Arabidopsis with 82.14% of identity |
Eggnog | Heat shock protein(COG0443) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449461.1) |
Pfam | Hsp70 protein (PF00012.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer