Transcript | Ll_transcript_337621 |
---|---|
CDS coordinates | 1191-1856 (+) |
Peptide sequence | MQNPGCLVMVDNCYGEFVESIEPPMVGADLIAGSLIKNPGGTIAPCGGYVAGRKKWVEAAAARLSAPGLGVDCGATPGDIMRAFFQGLFLSPQMVGEAIKGSLLIAEVLASEGYKVQPLPRVPRSDTVQAVQLGSRKRLLAFCEAVQRSSPVGSYTKPVAGTTPGYASEVIFADGTFIDGSTSELSCDGPLREPFAVFCQVGSFISYITTYDLPLFFMADF* |
ORF Type | complete |
Blastp | Uncharacterized protein YnbB from Bacillus with 43.75% of identity |
---|---|
Blastx | Uncharacterized protein YnbB from Bacillus with 42.72% of identity |
Eggnog | aluminum resistance protein(COG4100) |
Kegg | Link to kegg annotations (BSU17440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453605.1) |
Pfam | Methionine gamma-lyase (PF06838.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer