Protein coding transcript 58657

• Transcript: Ll_transcript_337624
• CDS coordinates: 2373-3041 (+)
• Peptide sequence: MQNPGCLVMVDNCYGEFVESIEPPMVGADLIAGSLIKNPGGTIAPCGGYVAGRKKWVEAAAARLSAPGLGVDCGATPGDIMRAFFQGLFLSPQMVGEAIKGSLLIAEVLASEGYKVQPLPRVPRSDTVQAVQLGSRKRLLAFCEAVQRSSPVGSYTKPVAGTTPGYASEVIFADGTFIDGSTSELSCDGPLREPFAVFCQGGTHWTQWGLVLAEVLKSIDGI*
• ORF Type: complete

Annotations of Ll_transcript_337624

• Blastp: Uncharacterized protein YnbB from Bacillus with 44.39% of identity
• Blastx: Uncharacterized protein YnbB from Bacillus with 43.33% of identity
• Eggnog: aluminum resistance protein(COG4100)
• Kegg: Link to kegg annotations (BSU17440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453605.1)
• Pfam: Methionine gamma-lyase (PF06838.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;