| Transcript | Ll_transcript_336657 |
|---|---|
| CDS coordinates | 53-400 (+) |
| Peptide sequence | MELGSSEEDAREEQQCLYEAYNELHSLAQDLHTPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMKYEPQCDSPHCYLLSDLDPTLYHHKSLPQIQGLSES* |
| ORF Type | complete |
| Blastp | Dynamin-like protein ARC5 from Arabidopsis with 71.05% of identity |
|---|---|
| Blastx | Dynamin-like protein ARC5 from Arabidopsis with 71.05% of identity |
| Eggnog | Dynamin family(COG0699) |
| Kegg | Link to kegg annotations (AT3G19720) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429278.1) |
| Pfam | Dynamin family (PF00350.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer