Protein coding transcript 58712

• Transcript: Ll_transcript_336678
• CDS coordinates: 65-418 (+)
• Peptide sequence: MRKKREEEEGEEGIKNDVLQKMPLFCKELVAGGLAGAFAKSVVAPLERLKILFQTRSGEFHTTGFVGSANRIAKTEGILGFYRLLLLTPHLNNFISLSYELTGRQVVPLHVPSTVIG*
• ORF Type: complete

Annotations of Ll_transcript_336678

• Blastp: Mitochondrial carrier protein CoAc2 from Arabidopsis with 62.67% of identity
• Blastx: Mitochondrial carrier protein CoAc2 from Zea with 51.68% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (AT4G26180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436200.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;