Protein coding transcript 58761

• Transcript: Ll_transcript_337747
• CDS coordinates: 111-788 (+)
• Peptide sequence: MSSMAALRREGKRLAPLIPSQSIRSPLSSPSLDQAPIGARSISTQIVRNRMKSVKNIQKITKAMKMVAASKLRAIQTRAENSRGLWQPFTALLGDSPSVEVKKNVVVTISSDKGLCGGINSTSVKISRVLSKLNSGPDKETKYVILGEKAKAQLTRDSKKDIEIIITELQKNPLNYTQVSVLADDILKNVEYDALRIVFNKFQSVVSFLPTVSTVLSPEVFLSIK*
• ORF Type: complete

Annotations of Ll_transcript_337747

• Blastp: ATP synthase subunit gamma, mitochondrial from Ipomoea with 82.51% of identity
• Blastx: ATP synthase subunit gamma, mitochondrial from Ipomoea with 81.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417641.1)
• Pfam: ATP synthase (PF00231.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;