Protein coding transcript 588

• Transcript: Ll_transcript_445466
• CDS coordinates: 1-303 (+)
• Peptide sequence: INPSYSGNKNRYLYAATTLGSRKTLPSFPFDTVVKLDLVNDSVQTWTVGSRRFIGEPIFVPKGHDEDDGYLLVVEYAVSMQRCYLVILNPKRIGSSNSVVA
• ORF Type: internal

Annotations of Ll_transcript_445466

• Blastp: Carotenoid cleavage dioxygenase 7, chloroplastic from Oryza sativa with 54.46% of identity
• Blastx: Carotenoid cleavage dioxygenase 7, chloroplastic from Oryza sativa with 54.46% of identity
• Eggnog: dioxygenase(COG3670)
• Kegg: Link to kegg annotations (4336591)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433092.1)
• Pfam: Retinal pigment epithelial membrane protein (PF03055.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;