Protein coding transcript 58817

• Transcript: Ll_transcript_337045
• CDS coordinates: 638-1084 (+)
• Peptide sequence: MAVAGEVSLDEHDMDFDQFGILIKVKFRETGQLQNLSAHHQSGGERSVSTIVYLVSLQDLTNCPFRVVDEINQGMDPINERKMFQQLVRAASKPNTPQCFLLTPKLLPDLQYSDACSILNVMTGPWIEQTSKVWTNGDRWGIITGLVQ*
• ORF Type: complete

Annotations of Ll_transcript_337045

• Blastp: Structural maintenance of chromosomes protein 5 from Arabidopsis with 85.11% of identity
• Blastx: Structural maintenance of chromosomes protein 5 from Arabidopsis with 81.25% of identity
• Eggnog: Required for chromosome condensation and partitioning (By similarity)(COG1196)
• Kegg: Link to kegg annotations (AT5G15920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427524.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;