| Transcript | Ll_transcript_338190 |
|---|---|
| CDS coordinates | 485-850 (+) |
| Peptide sequence | MSNLHYIFSVLVLLLLLQNPISTQSHTKGIRPGRSEGNGVTTNMTRVQFSEQQFMKWVKFVGGLKHTVFGTAKNKLFPSLTLQVSKNPSKGDFSSIQAAIDSLPFINLVRVVIKVHAGVYT* |
| ORF Type | complete |
| Blastp | Probable pectinesterase 53 from Arabidopsis with 63.27% of identity |
|---|---|
| Blastx | Probable pectinesterase 53 from Arabidopsis with 80.84% of identity |
| Eggnog | pectinesterase(COG4677) |
| Kegg | Link to kegg annotations (AT5G19730) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446394.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer