Protein coding transcript 58839

• Transcript: Ll_transcript_338197
• CDS coordinates: 485-1168 (+)
• Peptide sequence: MSNLHYIFSVLVLLLLLQNPISTQSHTKGIRPGRSEGNGVTTNMTRVQFSEQQFMKWVKFVGGLKHTVFGTAKNKLFPSLTLQVSKNPSKGDFSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVNIPPLKSFITIQGSGADKTIVQWGDTAQTPGPRGQPLGTYGSATFAVNSPYFIAKNITFKVKFPFLFFISNFCYIYVLTTKYYSYRTPPRFRHQEQLENRPWH*
• ORF Type: complete

Annotations of Ll_transcript_338197

• Blastp: Probable pectinesterase 53 from Arabidopsis with 65.66% of identity
• Blastx: Probable pectinesterase 53 from Arabidopsis with 65.66% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT5G19730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446394.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;