Transcript | Ll_transcript_339191 |
---|---|
CDS coordinates | 1-309 (+) |
Peptide sequence | IFLLQDLFLLYTFLSPFLSLLNFEERGGREREGKEKNIERNMAVSCASLRVVAFLGLIYAALISVASSQSPAPAPTSDGTTLDQAIACVLMLLALVLTYIIH* |
ORF Type | 5prime_partial |
Blastp | Arabinogalactan peptide 16 from Arabidopsis with 57.69% of identity |
---|---|
Blastx | - |
Eggnog | Arabinogalactan peptide(ENOG410Z4BH) |
Kegg | Link to kegg annotations (AT2G46330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003602192.1) |
Pfam | Arabinogalactan peptide (PF06376.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer