Transcript | Ll_transcript_369434 |
---|---|
CDS coordinates | 362-1165 (+) |
Peptide sequence | MPEDGVELTPRPQLLTKAEILRVANLFVSGGVNKIRLTGGEPTVRKDIEDICLELSNLKGLRTLSMTTNGIALARKLPKLKECGLTSLNISLDTLIPAKFELMTRRRGHEKVMDSINAAIDLGFNPVKVNCVIMRGFNDDEICDFVELTREKPINIRFIEFMPFDGNVWNVKKLVPYMEMMDTVVKRFPSLKRVQDHSTETAKNFTIDGHQGRVSFITSMTEHFCAGCNRLRLLADGNFKVCLFGPSEVSYVLAIKIQYIVCVAETS* |
ORF Type | complete |
Blastp | GTP 3',8-cyclase, mitochondrial from Arabidopsis with 82.8% of identity |
---|---|
Blastx | GTP 3',8-cyclase, mitochondrial from Arabidopsis with 83.4% of identity |
Eggnog | Catalyzes, together with MoaC, the conversion of 5'-GTP to cyclic pyranopterin monophosphate (cPMP or molybdopterin precursor Z) (By similarity)(COG2896) |
Kegg | Link to kegg annotations (AT2G31955) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454459.1) |
Pfam | Radical SAM superfamily (PF04055.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer