Transcript | Ll_transcript_368817 |
---|---|
CDS coordinates | 243-767 (+) |
Peptide sequence | MTTMRRFCCNDLLRFTAVNLDHLTETFNMSFYMTYLARWPDYFHVALAPGNRIMGYIMGKVEGQGESWHGHVTAVTVAPEFRRQQLAKKLMNLLENISDNNYNAYFVDLFVRASNAPAIKMYEKLGYVIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD* |
ORF Type | complete |
Blastp | N-terminal acetyltransferase B complex catalytic subunit NAA20 from Arabidopsis with 91.38% of identity |
---|---|
Blastx | N-terminal acetyltransferase B complex catalytic subunit NAA20 from Arabidopsis with 91.38% of identity |
Eggnog | acetyltransferase(COG0456) |
Kegg | Link to kegg annotations (AT1G03150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427877.1) |
Pfam | Acetyltransferase (GNAT) family (PF00583.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer