| Transcript | Ll_transcript_368821 |
|---|---|
| CDS coordinates | 1137-1502 (+) |
| Peptide sequence | MKSPIRRMSFRFLYYLQENWKRLWVLTLWVAIMIGLFAWKFFQYRNKDVFQIMGYCLLTAKGAAETLKFNMALILFPVCRNTITKLRSTKLSCFVPFDDNINFHKVPTNITRNPLDFILFC* |
| ORF Type | complete |
| Blastp | Respiratory burst oxidase homolog protein A from Solanum with 80.77% of identity |
|---|---|
| Blastx | Respiratory burst oxidase homolog protein A from Solanum with 73.78% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (102579392) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446559.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer