Protein coding transcript 59101

• Transcript: Ll_transcript_368823
• CDS coordinates: 2444-2824 (+)
• Peptide sequence: MIILMAIAFTLATKWFRRNIIKLPKPFSRLTGFNAFWYSHHLFIIVYVLLVVHGVKLYLVHKWYLQTTWMYLAVPVLLYVAERTLRFFRSGFYTVHLIKVAIYPGNVLTLQMSKPPQFRYKSGQYMF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_368823

• Blastp: Respiratory burst oxidase homolog protein F from Arabidopsis with 78.74% of identity
• Blastx: Respiratory burst oxidase homolog protein A from Solanum with 77.89% of identity
• Eggnog: NADPH Oxidase(ENOG410XNZY)
• Kegg: Link to kegg annotations (AT1G64060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020994267.1)
• Pfam: FAD-binding domain (PF08022.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;