| Transcript | Ll_transcript_368826 |
|---|---|
| CDS coordinates | 625-948 (+) |
| Peptide sequence | MEEEVKEIIMLSASANKLSRLKEQAEEYAALIMEELDPERLGYIEVGNIFNYILTFVLDTLIPHFTTVMINSLSISKVLVLGRNYCFIHHRTTTKEIRKYYPPMFHW* |
| ORF Type | complete |
| Blastp | Respiratory burst oxidase homolog protein F from Arabidopsis with 57.61% of identity |
|---|---|
| Blastx | Respiratory burst oxidase homolog protein F from Arabidopsis with 60.58% of identity |
| Eggnog | NADPH Oxidase(ENOG410XNZY) |
| Kegg | Link to kegg annotations (AT1G64060) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446559.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer