Protein coding transcript 59105

• Transcript: Ll_transcript_368832
• CDS coordinates: 1137-2018 (+)
• Peptide sequence: MKSPIRRMSFRFLYYLQENWKRLWVLTLWVAIMIGLFAWKFFQYRNKDVFQIMGYCLLTAKGAAETLKFNMALILFPVCRNTITKLRSTKLSCFVPFDDNINFHKTIAAAIVIGIILHVGDHLACDFPKLVHSSELLYEKYLNGVFGHHKPSYIDLVKGVEGVTGILMIILMAIAFTLATKWFRRNIIKLPKPFSRLTGFNAFWYSHHLFIIVYVLLVVHGVKLYLVHKWYLQTTWMYLAVPVLLYVAERTLRFFRSGFYTVHLIKVAIYPGNVLTLQMSKPPQFRYKSGQYMF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_368832

• Blastp: Respiratory burst oxidase homolog protein A from Solanum with 79.18% of identity
• Blastx: Respiratory burst oxidase homolog protein A from Solanum with 80.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102579392)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446559.1)
• Pfam: Ferric reductase like transmembrane component (PF01794.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;