Protein coding transcript 59306

• Transcript: Ll_transcript_368334
• CDS coordinates: 90-575 (+)
• Peptide sequence: MTMASLSLRFLSLTRRAFSSSSALNFSGGVSMVQGASRGIGLQFVKQLLENNDRGHVIATCRNPNSSTGLIHLKDKFADRLKILPLDLTDESSIEASALSIKDAYGHLNLLINASGILSIPQVLQPETTLNKLEKSSLMLAYEVNAVGPILVIKVTPPNFH*
• ORF Type: complete

Annotations of Ll_transcript_368334

• Blastp: Benzil reductase ((S)-benzoin forming) IRC24 from Saccharomyces with 36.56% of identity
• Blastx: Benzil reductase ((S)-benzoin forming) IRC24 from Saccharomyces with 36.96% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIR036C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418201.1)
• Pfam: KR domain (PF08659.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;