Protein coding transcript 59394

• Transcript: Ll_transcript_367832
• CDS coordinates: 392-691 (+)
• Peptide sequence: MLYQHIQMGGQANIENEVVCRFIFPERPGALMNFLDCFSPRWSITLFHYRGKGEMGANVLVGMHVPQNEMDEFRDRANKLGYDYTVVNDDHAFQLLAQK*
• ORF Type: complete

Annotations of Ll_transcript_367832

• Blastp: Threonine dehydratase biosynthetic, chloroplastic from Arabidopsis with 69.66% of identity
• Blastx: Threonine dehydratase biosynthetic, chloroplastic from Arabidopsis with 71.08% of identity
• Eggnog: Threonine dehydratase(COG1171)
• Kegg: Link to kegg annotations (AT3G10050)
• CantataDB: Link to cantataDB annotations (CNT0000355)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447178.1)
• Pfam: C-terminal regulatory domain of Threonine dehydratase (PF00585.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;