Protein coding transcript 59661

• Transcript: Ll_transcript_369827
• CDS coordinates: 277-1215 (+)
• Peptide sequence: MHFVDFYNCWNDYQKEMSTQVFLLCDKAKDANFILISFRGTELFDADDWSTDFDYSWYEIPNIGKLHMGFLEALGLGNRIEPSTFYFHLQMKNKSSETRPEKTETTAYYTLRTKLRSLLEEHKNAKFIVTGHSLGGALAILFPTILVMHEEMDIMEKLLGIYTFGQPRIGDRQLGRFMEAYLEQPVPKYFRVVYCNDLVPRLPYDNKTFLYKHFGLCLYYNSFYREKEMEEEPNRNFFGMRFMLSEHVNAVWELMRGLTIGYIEGPEYKEGWFCIFARVIGLVFPGVSAHCSTDYVNSMRLGKHSFIQMSLL*
• ORF Type: complete

Annotations of Ll_transcript_369827

• Blastp: Lipase from Thermomyces with 33.65% of identity
• Blastx: Lipase from Thermomyces with 33.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418708.1)
• Pfam: Lipase (class 3) (PF01764.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;