Protein coding transcript 59713

• Transcript: Ll_transcript_368779
• CDS coordinates: 712-1431 (+)
• Peptide sequence: MAVKQAEMGTELIDHLTLEEKKLLSDLNPEIKDLKEKLVASKAERVETETRKSELETNLTTNLRRRKQELEVVISSVDADFLDDDAELKGKEELSSAKKSVDDATTQLRGVSESIKDRTSQIKKIKDEMNKLKSLEDDYERRLQEEAKELEQLLSKKNIYSSKEDEYTKKIRELGPLTSDAFEAYKRRNIKDLHKMLHRCNEQLQQFSHVNKKALDQYINFTEQREELQKRQAELDAGDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_368779

• Blastp: Structural maintenance of chromosomes protein 3 from Arabidopsis with 65% of identity
• Blastx: Structural maintenance of chromosomes protein 3 from Arabidopsis with 62.87% of identity
• Eggnog: Required for chromosome condensation and partitioning (By similarity)(COG1196)
• Kegg: Link to kegg annotations (AT2G27170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434196.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;